Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF397 Peptide - middle region

ZNF397 Peptide - middle region

Product Specifications

Product Name Alternative

ZNF47, ZSCAN15

UniProt

Q8NF99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF397 Rabbit Polyclonal Antibody (orb580117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115723

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQFRKFCYQETPGPREALSRLQELCYQWLMPELHTKEQILELLVLEQFLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3117391
S1313-5mg 5 mg

GSK3117391

Sign In for Pricing
View Details
Human Gingival Stem Cells
AFG-ELL-1869 > 5x 10^5 Cells / Vial

Human Gingival Stem Cells

Sign In for Pricing
View Details
ERN2 Antibody : Biotin (OAAF02511-Biotin)
OAAF02511-100UG-Biotin 100 µg

ERN2 Antibody : Biotin (OAAF02511-Biotin)

Sign In for Pricing
View Details
RET (NM_020975) Human Recombinant Protein
PH32906M2 20 µg

RET (NM_020975) Human Recombinant Protein

Sign In for Pricing
View Details
NUPL1 (NUP58) (NM_014089) Human Recombinant Protein
TP300043M 100 µg

NUPL1 (NUP58) (NM_014089) Human Recombinant Protein

Sign In for Pricing
View Details
Pacific Blue anti-mouse CD38
FC1202 100 Tests

Pacific Blue anti-mouse CD38

Sign In for Pricing
View Details