Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF397 Peptide - middle region

ZNF397 Peptide - middle region

Product Specifications

Product Name Alternative

ZNF47, ZSCAN15

UniProt

Q8NF99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF397 Rabbit Polyclonal Antibody (orb580117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115723

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQFRKFCYQETPGPREALSRLQELCYQWLMPELHTKEQILELLVLEQFLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 3 (CASP3) Antibody
abx432452 200 µL

Caspase 3 (CASP3) Antibody

Sign In for Pricing
View Details
Synaptophysin
MO20000 100 µL

Synaptophysin

Sign In for Pricing
View Details
L3MBTL2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2495658 100 µL

L3MBTL2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Prohibitin Antibody
3805-100 100 µg

Prohibitin Antibody

Sign In for Pricing
View Details
Goose Microseminoprotein Beta ELISA Kit
MBS097820 Inquire

Goose Microseminoprotein Beta ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CCL21/6Ckine Antibody (MM0146-2H26) [mFluor Violet 450 SE]
NBP2-12103MFV450 0.1 mL

Mouse Monoclonal CCL21/6Ckine Antibody (MM0146-2H26) [mFluor Violet 450 SE]

Sign In for Pricing
View Details