Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF506 Peptide - C-terminal region

ZNF506 Peptide - C-terminal region

Product Specifications

UniProt

Q5JVG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF506 Rabbit Polyclonal Antibody (orb580144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138876

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red® alkyne *Single Isomer*
485-AAT 5 mg

Texas Red® alkyne *Single Isomer*

Sign In for Pricing
View Details
Human OCC1 (C12orf75) activation kit by CRISPRa
GA117917 1 Kit

Human OCC1 (C12orf75) activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF594 conjugate, 0.1mg/mL
BNC941577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS503497 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Bulk Anti-Human CD11a (38) Antibody
ICH1006-100mg 100 mg

Bulk Anti-Human CD11a (38) Antibody

Sign In for Pricing
View Details
CD79a Rabbit Polyclonal Antibody
R1204-4 100 µL

CD79a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details