Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF506 Peptide - C-terminal region

ZNF506 Peptide - C-terminal region

Product Specifications

UniProt

Q5JVG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF506 Rabbit Polyclonal Antibody (orb580144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138876

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human WBP1 Protein (His Tag)
PKSH033226-01 10 µg

Recombinant Human WBP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human WBP1 Protein (His Tag)
PKSH033226-02 50 µg

Recombinant Human WBP1 Protein (His Tag)

Sign In for Pricing
View Details
PTPRB (NM_001109754) Human Over-expression Lysate
LC426301 20 µg

PTPRB (NM_001109754) Human Over-expression Lysate

Sign In for Pricing
View Details
MHC II (HLA-DP) (beta chain) (Bra-14), CF640R conjugate, 0.1mg/mL
BNC401129-100 1x 100 µL

MHC II (HLA-DP) (beta chain) (Bra-14), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DPP7 Antibody
KC-3156-01 50 μL

DPP7 Antibody

Sign In for Pricing
View Details
DPP7 Antibody
KC-3156-02 100 µL

DPP7 Antibody

Sign In for Pricing
View Details