Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAML3 Peptide - C-terminal region

MAML3 Peptide - C-terminal region

Product Specifications

UniProt

H0YGR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAML3 Rabbit Polyclonal Antibody (orb580149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQQGAQSWQQRSLQGMPGRTSGELGPFNNGASYPLQAGQPRLTKQHFPQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF765 Human shRNA Plasmid Kit (Locus ID 91661)
TR315473 1 Kit

ZNF765 Human shRNA Plasmid Kit (Locus ID 91661)

Sign In for Pricing
View Details
IMMT Antibody
MBS8516516-01 0.1 mg

IMMT Antibody

Sign In for Pricing
View Details
IMMT Antibody
MBS8516516-02 0.1 mL (AF635)

IMMT Antibody

Sign In for Pricing
View Details
IMMT Antibody
MBS8516516-03 0.1 mL (AF610)

IMMT Antibody

Sign In for Pricing
View Details
IMMT Antibody
MBS8516516-04 0.1 mL (AF405S)

IMMT Antibody

Sign In for Pricing
View Details
IMMT Antibody
MBS8516516-05 0.1 mL (AF405L)

IMMT Antibody

Sign In for Pricing
View Details