Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAML3 Peptide - C-terminal region

MAML3 Peptide - C-terminal region

Product Specifications

UniProt

H0YGR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAML3 Rabbit Polyclonal Antibody (orb580149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQQGAQSWQQRSLQGMPGRTSGELGPFNNGASYPLQAGQPRLTKQHFPQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR23 (DCAF11) (NM_001163484) Human Tagged Lenti ORF Clone
RC228951L4 10 µg

WDR23 (DCAF11) (NM_001163484) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Urea
MA-0118 100 Well

Urea

Sign In for Pricing
View Details
Lentiviral human FAXC shRNA (UAS) - Lentiviral human FAXC shRNA (UAS, RFP) plasmid
GTR15345016 1 Vial

Lentiviral human FAXC shRNA (UAS) - Lentiviral human FAXC shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Ethyl 4-Oxo-4- (P-Tolyl) Butanoate
OR1013212 1 Each

Ethyl 4-Oxo-4- (P-Tolyl) Butanoate

Sign In for Pricing
View Details
NUDT16 Rabbit pAb
E45R24026N-50 50 µL

NUDT16 Rabbit pAb

Sign In for Pricing
View Details
ARVCF Protein Lysate (Mouse) with C-HA Tag
12484034 100 µg

ARVCF Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details