ZSCAN21 Peptide - middle region
ZSCAN21 Peptide - middle region
Product Specifications
Product Name Alternative
NY-REN-21, ZNF38, Zipro1
UniProt
Q9Y5A6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZSCAN21 Rabbit Polyclonal Antibody (orb580186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_666019
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM040497 100 µg
Recombinant Mouse LILRB3/LIR3/ILT5/CD85a Protein (His Tag)
Sign In for Pricing
View Details 
