TAMM41 Peptide - C-terminal region
TAMM41 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C3orf31, TAM41
UniProt
Q96BW9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAMM41 Rabbit Polyclonal Antibody (orb325360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_620162
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![6-ROX, SE [6-Carboxy-X-rhodamine, succinimidyl ester] *CAS#: 216699-36-4*](https://cdn.genprice.uk/products/271/7358614/imageurl/392-aat.webp)
392-AAT 5 mg
6-ROX, SE [6-Carboxy-X-rhodamine, succinimidyl ester] *CAS#: 216699-36-4*
Sign In for Pricing
View Details 
LY418997 100 µg
Ribophorin I (RPN1) (NM_002950) Human Over-expression Lysate
Sign In for Pricing
View Details