TAMM41 Peptide - C-terminal region
TAMM41 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C3orf31, TAM41
UniProt
Q96BW9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAMM41 Rabbit Polyclonal Antibody (orb325360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_620162
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d37f7/imageurl/e-ab-f1185l.webp)
E-AB-F1185L-01 50 Tests
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
Sign In for Pricing
View Details E-AB-F1185L-02 100 Tests
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
Sign In for Pricing
View Details E-AB-F1185L-03 2x 100 Tests
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
Sign In for Pricing
View Details 
BNC042311-100 1x 100 µL
SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details