Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATRX Peptide - C-terminal region

ATRX Peptide - C-terminal region

Product Specifications

UniProt

P46100

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATRX Rabbit Polyclonal Antibody (orb330519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decamethylenebispyridinium dibromide
GAA26640-01 50 mg

Decamethylenebispyridinium dibromide

Sign In for Pricing
View Details
Decamethylenebispyridinium dibromide
GAA26640-02 0.5 g

Decamethylenebispyridinium dibromide

Sign In for Pricing
View Details
DPYS Rabbit Polyclonal Antibody (Cy3)
orb2590130 100 µg

DPYS Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
VLDLR antibody
70R-21255 50 ul

VLDLR antibody

Sign In for Pricing
View Details
Chicken Protein Sidekick-2 (SDK2) ELISA Kit
MBS9942207 Inquire

Chicken Protein Sidekick-2 (SDK2) ELISA Kit

Sign In for Pricing
View Details
Benchtop pH/mV Meter BMET-1302
BMET-1302 Each

Benchtop pH/mV Meter BMET-1302

Sign In for Pricing
View Details