Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATRX Peptide - C-terminal region

ATRX Peptide - C-terminal region

Product Specifications

UniProt

P46100

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATRX Rabbit Polyclonal Antibody (orb330519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CECR6 shRNA Plasmid (h)
sc-72858-SH 20 µg

CECR6 shRNA Plasmid (h)

Sign In for Pricing
View Details
Olfr328 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
33073114 3x 1.0 µg

Olfr328 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Stathmin 1 (STMN1) Cell ELISA Kit
abx595570 96 Tests

Stathmin 1 (STMN1) Cell ELISA Kit

Sign In for Pricing
View Details
Recombinant Intercellular Adhesion Molecule 5 (ICAM5)
TRV-0007308-01 10 µg

Recombinant Intercellular Adhesion Molecule 5 (ICAM5)

Sign In for Pricing
View Details
Recombinant Intercellular Adhesion Molecule 5 (ICAM5)
TRV-0007308-02 50 µg

Recombinant Intercellular Adhesion Molecule 5 (ICAM5)

Sign In for Pricing
View Details
Recombinant Intercellular Adhesion Molecule 5 (ICAM5)
TRV-0007308-03 100 µg

Recombinant Intercellular Adhesion Molecule 5 (ICAM5)

Sign In for Pricing
View Details