ZNF625 Peptide - middle region
ZNF625 Peptide - middle region
Product Specifications
UniProt
Q96I27
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF625 Rabbit Polyclonal Antibody (orb581163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VGHASLNRHHRADTGHKPYEYQEYGQKPYKCTYCKKAFSDLPYFRTHEWA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
Parp1-2535MAF555 20 μg- 50 μg- 100 μg
Recombinant Mouse Parp1 Protein, His-tagged, Alexa Fluor 555 conjugated
Sign In for Pricing
View Details 
bs-3427R-RBITC 100 µL
Phospho-STAT1 (Ser727) Polyclonal Antibody, RBITC Conjugated
Sign In for Pricing
View Details 324039 100 µL
MEK-5 (Dual specificity mitogen-activated protein kinase kinase 5, MAP2K5)
Sign In for Pricing
View Details