Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF625 Peptide - middle region

ZNF625 Peptide - middle region

Product Specifications

UniProt

Q96I27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF625 Rabbit Polyclonal Antibody (orb581163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGHASLNRHHRADTGHKPYEYQEYGQKPYKCTYCKKAFSDLPYFRTHEWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pde4dip Mouse Gene Knockout Kit (CRISPR)
KN513018 1 Kit

Pde4dip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMELY sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11832111 3x 1.0 µg

AMELY sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
2,4,6-Trichlorophenol Sodium Salt
sc-475034 25 g

2,4,6-Trichlorophenol Sodium Salt

Sign In for Pricing
View Details
TAF I p48 (A-10)
sc-393600 200 µg/mL

TAF I p48 (A-10)

Sign In for Pricing
View Details
RIPK3/RIP3 Mouse mAb
E2620375 100 µL

RIPK3/RIP3 Mouse mAb

Sign In for Pricing
View Details
GENLISA Canine Bcl-2 Associated X Protein (BAX) ELISA
KLN0560 1x 96 Well

GENLISA Canine Bcl-2 Associated X Protein (BAX) ELISA

Sign In for Pricing
View Details