SETMAR Peptide - C-terminal region
SETMAR Peptide - C-terminal region
Product Specifications
UniProt
E7EN68
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SETMAR Rabbit Polyclonal Antibody (orb330629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001230652
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
026632-01 48 Tests
Macrophage Inflammatory Protein 1 Beta (MIP1b) BioAssayTM ELISA Kit (Porcine) discontinued
Sign In for Pricing
View Details 026632-02 96 Tests
Macrophage Inflammatory Protein 1 Beta (MIP1b) BioAssayTM ELISA Kit (Porcine) discontinued
Sign In for Pricing
View Details