Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETMAR Peptide - C-terminal region

SETMAR Peptide - C-terminal region

Product Specifications

UniProt

E7EN68

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SETMAR Rabbit Polyclonal Antibody (orb330629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230652

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT3 siRNA (Mouse)
CRM5780-01 15 nmol

NUDT3 siRNA (Mouse)

Sign In for Pricing
View Details
NUDT3 siRNA (Mouse)
CRM5780-02 30 nmol

NUDT3 siRNA (Mouse)

Sign In for Pricing
View Details
EphA3 Rabbit Polyclonal Antibody (BF680)
orb2395541 100 µL

EphA3 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CCDC3 Rabbit pAb
MBS9145500-01 0.02 mL

CCDC3 Rabbit pAb

Sign In for Pricing
View Details
CCDC3 Rabbit pAb
MBS9145500-02 0.1 mL

CCDC3 Rabbit pAb

Sign In for Pricing
View Details
CCDC3 Rabbit pAb
MBS9145500-03 5x 0.1 mL

CCDC3 Rabbit pAb

Sign In for Pricing
View Details