DKFZp686P1551 Peptide - C-terminal region
DKFZp686P1551 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EX070, EXO70, EXOC1, 2-5-3p, Exo70p, YJL085W, DKFZp686P1551
UniProt
Q63HP7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DKFZp686P1551 Rabbit Polyclonal Antibody (orb325916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881045-100 1x 100 µL
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880158-100 1x 100 µL
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 