TBC1D28 Peptide - middle region
TBC1D28 Peptide - middle region
Product Specifications
UniProt
Q2M2D7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBC1D28 Rabbit Polyclonal Antibody (orb582356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034486
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QKMLADWTKYRSTKKLSQRVCKVIPLAVRGRALSLLLDIDKIKSQNPGKY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PT_40242-01 5 µg
Calcium Binding Protein P22 Human Recombinant (CHP Human)
Sign In for Pricing
View Details PT_40242-02 25 µg
Calcium Binding Protein P22 Human Recombinant (CHP Human)
Sign In for Pricing
View Details PT_40242-03 1 mg
Calcium Binding Protein P22 Human Recombinant (CHP Human)
Sign In for Pricing
View Details 
K3422503 1.0 µg DNA
Lmnb2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details LV622370 1.0 µg DNA
MARCO Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details