Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX9 Peptide - middle region

TEX9 Peptide - middle region

Product Specifications

UniProt

B4DH73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX9 Rabbit Polyclonal Antibody (orb582934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSNDIGTEAQIRFLKAKLHVMQEELDNVVCECNKKEDEIQNLKSQVKNFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POMZP3 Protein Lysate
MBS8417540-01 0.02 mg

Human POMZP3 Protein Lysate

Sign In for Pricing
View Details
Human POMZP3 Protein Lysate
MBS8417540-02 5x 0.02 mg

Human POMZP3 Protein Lysate

Sign In for Pricing
View Details
Ermanin
380234 10 mg

Ermanin

Sign In for Pricing
View Details
Anti-Human LINGO1 Antibody (SAA0824), FITC
FHJ39111 100 Tests

Anti-Human LINGO1 Antibody (SAA0824), FITC

Sign In for Pricing
View Details
RINT1 cDNA Clone
MBS1272407-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RINT1 cDNA Clone

Sign In for Pricing
View Details
RINT1 cDNA Clone
MBS1272407-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

RINT1 cDNA Clone

Sign In for Pricing
View Details