Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX9 Peptide - middle region

TEX9 Peptide - middle region

Product Specifications

UniProt

B4DH73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX9 Rabbit Polyclonal Antibody (orb582934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSNDIGTEAQIRFLKAKLHVMQEELDNVVCECNKKEDEIQNLKSQVKNFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PECI Protein
NBP1-45270-0.5mg 0.5 mg

Recombinant Human PECI Protein

Sign In for Pricing
View Details
Fluorescein Isothiocyanate (FITC) (HRP)
MBS6128661-01 0.1 mL

Fluorescein Isothiocyanate (FITC) (HRP)

Sign In for Pricing
View Details
Fluorescein Isothiocyanate (FITC) (HRP)
MBS6128661-02 5x 0.1 mL

Fluorescein Isothiocyanate (FITC) (HRP)

Sign In for Pricing
View Details
1-Phenyl-1H-tetrazole-5-thiol sodium salt
sc-222727 5 g

1-Phenyl-1H-tetrazole-5-thiol sodium salt

Sign In for Pricing
View Details
Porcine Chemokine C-C-Motif Ligand 14 ELISA Kit
MBS736030-01 48 Well

Porcine Chemokine C-C-Motif Ligand 14 ELISA Kit

Sign In for Pricing
View Details
Porcine Chemokine C-C-Motif Ligand 14 ELISA Kit
MBS736030-02 96 Well

Porcine Chemokine C-C-Motif Ligand 14 ELISA Kit

Sign In for Pricing
View Details