Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF44 Peptide - N-terminal region

ZNF44 Peptide - N-terminal region

Product Specifications

UniProt

P15621

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF44 Rabbit Polyclonal Antibody (orb583843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNB1 (NM_000723) Human Recombinant Protein
TP307230L 1 mg

CACNB1 (NM_000723) Human Recombinant Protein

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD20 Antibody[BCA/B20]
E-AB-F1045J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD20 Antibody[BCA/B20]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD20 Antibody[BCA/B20]
E-AB-F1045J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD20 Antibody[BCA/B20]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD20 Antibody[BCA/B20]
E-AB-F1045J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD20 Antibody[BCA/B20]

Sign In for Pricing
View Details
rac-gamma-Nonanolactone
TRC-N649360-500G 500 g

rac-gamma-Nonanolactone

Sign In for Pricing
View Details
4-Chloro-5-fluoro-2-nitrobenzoic Acid
TRC-C367015-50MG 50 mg

4-Chloro-5-fluoro-2-nitrobenzoic Acid

Sign In for Pricing
View Details