ZNF44 Peptide - N-terminal region
ZNF44 Peptide - N-terminal region
Product Specifications
UniProt
P15621
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF44 Rabbit Polyclonal Antibody (orb583843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0735-100 1x 100 µL
Human Lambda Light Chain (LcN-2 + ICO-106), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1985-100 1x 100 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details