ZNF563 Peptide - middle region
ZNF563 Peptide - middle region
Product Specifications
UniProt
Q8TA94
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF563 Rabbit Polyclonal Antibody (orb583908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042913-APC 200 µL
TMC8, NT (TMC8, EVER2, EVIN2, Transmembrane channel-like protein 8, Epidermodysplasia verruciformis protein 2) (APC) discontinued
Sign In for Pricing
View Details 
K2817204 1.0 µg DNA
VOPP1 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 125459-ML750 100 µL
CTNND2 (Catenin delta-2, Delta-catenin, GT24, Neural Plakophilin-related ARM-repeat Protein, NPRAP, Neurojungin, NPRAP) (MaxLight 750) discontinued
Sign In for Pricing
View Details