Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF563 Peptide - middle region

ZNF563 Peptide - middle region

Product Specifications

UniProt

Q8TA94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF563 Rabbit Polyclonal Antibody (orb583908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (MaxLight 650)
243822-ML650 100 µL

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (MaxLight 650)

Sign In for Pricing
View Details
TBX6, CT (TBX6, T-box transcription factor TBX6) (MaxLight 490)
MBS6354244-01 0.1 mL

TBX6, CT (TBX6, T-box transcription factor TBX6) (MaxLight 490)

Sign In for Pricing
View Details
TBX6, CT (TBX6, T-box transcription factor TBX6) (MaxLight 490)
MBS6354244-02 5x 0.1 mL

TBX6, CT (TBX6, T-box transcription factor TBX6) (MaxLight 490)

Sign In for Pricing
View Details
Ceacam10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV649418 1.0 µg DNA

Ceacam10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Hsa-miR-568 miRNA Inhibitor
orb1873168-01 10 nmol

Hsa-miR-568 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-568 miRNA Inhibitor
orb1873168-02 20 nmol

Hsa-miR-568 miRNA Inhibitor

Sign In for Pricing
View Details