PSEN2 Peptide - C-terminal region
PSEN2 Peptide - C-terminal region
Product Specifications
UniProt
E5RG63
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PSEN2 Rabbit Polyclonal Antibody (orb584173) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MSX1 Mouse Monoclonal Antibody [Clone ID: 5D11]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbe75/imageurl/am06610su-n.webp)
