Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOC2B Peptide - C-terminal region

DOC2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

DOC2BL

UniProt

Q14184

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOC2B Rabbit Polyclonal Antibody (orb584359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003576.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Islet amyloid polypeptide, IAPP ELISA KIT
E1128Mo-01 48 Well

Mouse Islet amyloid polypeptide, IAPP ELISA KIT

Sign In for Pricing
View Details
Mouse Islet amyloid polypeptide, IAPP ELISA KIT
E1128Mo-02 96 Well

Mouse Islet amyloid polypeptide, IAPP ELISA KIT

Sign In for Pricing
View Details
Mouse Islet amyloid polypeptide, IAPP ELISA KIT
E1128Mo-03 5x 96 Tests

Mouse Islet amyloid polypeptide, IAPP ELISA KIT

Sign In for Pricing
View Details
Mouse Islet amyloid polypeptide, IAPP ELISA KIT
E1128Mo-04 10x 96 Tests

Mouse Islet amyloid polypeptide, IAPP ELISA KIT

Sign In for Pricing
View Details
Cytokeratin 8 (CK8) Magnetic Luminex Assay Kit
LKU607132 96 Tests

Cytokeratin 8 (CK8) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
PRL (Prolactin, LTH, Luteotropic Hormone)
364752 200 µL

PRL (Prolactin, LTH, Luteotropic Hormone)

Sign In for Pricing
View Details