Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOC2B Peptide - C-terminal region

DOC2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

DOC2BL

UniProt

Q14184

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOC2B Rabbit Polyclonal Antibody (orb584359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003576.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXD4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-17372R-BF405 100 µL

HOXD4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)
abx337998-01 20 µg

Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)

Sign In for Pricing
View Details
Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)
abx337998-02 50 µg

Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)

Sign In for Pricing
View Details
Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)
abx337998-03 100 µg

Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)

Sign In for Pricing
View Details
Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)
abx337998-04 200 µg

Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)

Sign In for Pricing
View Details
Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)
abx337998-05 1 mg

Transcription Factor AP-2-Beta (TFAP2B) Antibody (Biotin)

Sign In for Pricing
View Details