Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olr806 Peptide - middle region

Olr806 Peptide - middle region

Product Specifications

UniProt

D3ZFL4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olr806 Rabbit Polyclonal Antibody (orb326310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001000976

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP6 Human Gene Knockout Kit (CRISPR)
KN415749 1 Kit

USP6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sodium Metasilicate
TRC-S224405-1G 1 g

Sodium Metasilicate

Sign In for Pricing
View Details
INTS5 (NM_030628) Human Recombinant Protein
TP309283M 100 µg

INTS5 (NM_030628) Human Recombinant Protein

Sign In for Pricing
View Details
Human MTBP activation kit by CRISPRa
GA108997 1 Kit

Human MTBP activation kit by CRISPRa

Sign In for Pricing
View Details
Stat3 Mouse Gene Knockout Kit (CRISPR)
KN316845LP 1 Kit

Stat3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dihydropyrimidinase (DPYS) (NM_001385) Human Recombinant Protein
TP306603L 1 mg

Dihydropyrimidinase (DPYS) (NM_001385) Human Recombinant Protein

Sign In for Pricing
View Details