Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olr806 Peptide - middle region

Olr806 Peptide - middle region

Product Specifications

UniProt

D3ZFL4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olr806 Rabbit Polyclonal Antibody (orb326310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001000976

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Receptor (PR501), CF640R conjugate, 0.1mg/mL
BNC400501-500 1x 500 µL

Progesterone Receptor (PR501), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRPC4AP (NM_015638) Human Over-expression Lysate
LY402454 100 µg

TRPC4AP (NM_015638) Human Over-expression Lysate

Sign In for Pricing
View Details
GIPC3 Human Gene Knockout Kit (CRISPR)
KN419539 1 Kit

GIPC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Snap25 Mouse Gene Knockout Kit (CRISPR)
KN516371 1 Kit

Snap25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2310004N24Rik (BC027639) Mouse Tagged ORF Clone
MG201257 10 µg

2310004N24Rik (BC027639) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant eIF3G Monoclonal Antibody
AN301973L-01 50 µL

Recombinant eIF3G Monoclonal Antibody

Sign In for Pricing
View Details