Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD10 Peptide - C-terminal region

ACAD10 Peptide - C-terminal region

Product Specifications

UniProt

Q6JQN1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAD10 Rabbit Polyclonal Antibody (orb584800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 (CCND1) (NM_053056) Human Recombinant Protein
TP304957M 100 µg

Cyclin D1 (CCND1) (NM_053056) Human Recombinant Protein

Sign In for Pricing
View Details
MESD (NM_015154) Human Over-expression Lysate
LC402437 20 µg

MESD (NM_015154) Human Over-expression Lysate

Sign In for Pricing
View Details
Hexokinase II (HK2) Human Gene Knockout Kit (CRISPR)
KN209482LP 1 Kit

Hexokinase II (HK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZC3H18 activation kit by CRISPRa
GA114833 1 Kit

Human ZC3H18 activation kit by CRISPRa

Sign In for Pricing
View Details
Claudin 2 (CLDN2) (N-term) Rabbit Polyclonal Antibody
AP13332PU-N 400 µL

Claudin 2 (CLDN2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TMEM63B activation kit by CRISPRa
GA110737 1 Kit

Human TMEM63B activation kit by CRISPRa

Sign In for Pricing
View Details