ACAD10 Peptide - C-terminal region
ACAD10 Peptide - C-terminal region
Product Specifications
UniProt
Q6JQN1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACAD10 Rabbit Polyclonal Antibody (orb584800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP13446PU-N 400 µL
IL3RB (CSF2RB) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
TRC-A169125-25MG 25 mg
L-Arginine-L-phenylalanine-L-arginine-L-tryptophan-L-proline-L-tyrosine-L-arginine-L-isoleucine-L-arginine-L-glutamic acid-L-phenylalanine TFA Salt (95%)
Sign In for Pricing
View Details ![PMCA1 Recombinant Rabbit Monoclonal Antibody [JE34-05]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81651/imageurl/ha722186.webp)
HA722186 100 µL
PMCA1 Recombinant Rabbit Monoclonal Antibody [JE34-05]
Sign In for Pricing
View Details 
