ACAD10 Peptide - C-terminal region
ACAD10 Peptide - C-terminal region
Product Specifications
UniProt
Q6JQN1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACAD10 Rabbit Polyclonal Antibody (orb584801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R-4601-2 2 mg
TRITC Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-
Sign In for Pricing
View Details ![SHP2 (PTPN11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F4]](https://cdn.genprice.uk/products/937/6868c332994c49e6dc3f103d/imageurl/ta501759bm.webp)
TA501759BM 100 µL
SHP2 (PTPN11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F4]
Sign In for Pricing
View Details 