Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD10 Peptide - C-terminal region

ACAD10 Peptide - C-terminal region

Product Specifications

UniProt

Q6JQN1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAD10 Rabbit Polyclonal Antibody (orb584801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxyfedrine
TRC-O870700-5MG 5 mg

Oxyfedrine

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Anti-HPA Antibody
BAL-3601-2 2 mL

Biotin Conjugated Rabbit Anti-HPA Antibody

Sign In for Pricing
View Details
LI Cadherin (CDH17) Human Gene Knockout Kit (CRISPR)
KN211298LP 1 Kit

LI Cadherin (CDH17) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL
BNC472332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Phenoxyphenol
TRC-P301380-25G 25 g

4-Phenoxyphenol

Sign In for Pricing
View Details
RASA1 Recombinant Rabbit Monoclonal Antibody [JE60-89]
HA720052 100 µL

RASA1 Recombinant Rabbit Monoclonal Antibody [JE60-89]

Sign In for Pricing
View Details