ACSBG1 Peptide - C-terminal region
ACSBG1 Peptide - C-terminal region
Product Specifications
UniProt
F5H4U6
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACSBG1 Rabbit Polyclonal Antibody (orb331109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15318575 1 Vial
Lentiviral human MYL5 shRNA (UAS) - Lentiviral human MYL5 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
GTR15274518 1 Vial
Lentiviral mouse Akap17b shRNA (UAS) - Lentiviral mouse Akap17b shRNA (UAS) (100)
Sign In for Pricing
View Details 