ACSBG1 Peptide - C-terminal region
ACSBG1 Peptide - C-terminal region
Product Specifications
UniProt
F5H4U6
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACSBG1 Rabbit Polyclonal Antibody (orb331109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6259484-01 0.1 mL
CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (MaxLight 490)
Sign In for Pricing
View Details MBS6259484-02 5x 0.1 mL
CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (MaxLight 490)
Sign In for Pricing
View Details 
orb23418 1 mg
Salmonella species (A, B, C, D, E, F & G Groups) Antibody
Sign In for Pricing
View Details 