FSTL4 Peptide - N-terminal region
FSTL4 Peptide - N-terminal region
Product Specifications
UniProt
Q6MZW2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FSTL4 Rabbit Polyclonal Antibody (orb326447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941081-500 1x 500 µL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051037-500 1x 500 µL
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details