Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-A Peptide - N-terminal region

HLA-A Peptide - N-terminal region

Product Specifications

UniProt

Q1XG28

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-A Rabbit Polyclonal Antibody (orb585486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dichloroethylene-d2 Cis/Trans Mix
D437395 10 mg

1,2-Dichloroethylene-d2 Cis/Trans Mix

Sign In for Pricing
View Details
Sfrp4 AAV siRNA Pooled Vector
43585164 1.0 µg

Sfrp4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial
MBS9423616-01 0.02 mg

Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial

Sign In for Pricing
View Details
Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial
MBS9423616-02 0.1 mg

Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial

Sign In for Pricing
View Details
Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial
MBS9423616-03 1 mg

Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial

Sign In for Pricing
View Details
Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial
MBS9423616-04 5x 1 mg

Recombinant Human Anthrax toxin receptor 1 (ANTXR1), partial

Sign In for Pricing
View Details