Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-A Peptide - N-terminal region

HLA-A Peptide - N-terminal region

Product Specifications

UniProt

Q1XG28

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-A Rabbit Polyclonal Antibody (orb585486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAT1A Rabbit Polyclonal Antibody
TA346036 100 µL

MAT1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FRMD6-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV761579 1.0 µg DNA

FRMD6-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral human SAP30L shRNA (UAS) - Lentiviral human SAP30L shRNA (UAS, GFP) (100)
GTR15352968 1 Vial

Lentiviral human SAP30L shRNA (UAS) - Lentiviral human SAP30L shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
OR2M2 antibody - C-terminal region (ARP59740_P050)
ARP59740_P050 100 µL

OR2M2 antibody - C-terminal region (ARP59740_P050)

Sign In for Pricing
View Details
TMBIM6 Rabbit pAb
MBS9143510-01 0.02 mL

TMBIM6 Rabbit pAb

Sign In for Pricing
View Details
TMBIM6 Rabbit pAb
MBS9143510-02 0.1 mL

TMBIM6 Rabbit pAb

Sign In for Pricing
View Details