ALOX5 Peptide - C-terminal region
ALOX5 Peptide - C-terminal region
Product Specifications
UniProt
B7ZLS0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ALOX5 Rabbit Polyclonal Antibody (orb331210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001243083
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH033498-01 10 µg
Recombinant Human TNFSF14/LIGHT Protein (His Tag)
Sign In for Pricing
View Details PKSH033498-02 50 µg
Recombinant Human TNFSF14/LIGHT Protein (His Tag)
Sign In for Pricing
View Details 
![BD4 (DEFB104A) (3-39) Mouse Monoclonal Antibody [Clone ID: L13-10-D1]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb923/imageurl/am02223pu-s.webp)
AM02223PU-S 10 µg
BD4 (DEFB104A) (3-39) Mouse Monoclonal Antibody [Clone ID: L13-10-D1]
Sign In for Pricing
View Details