Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALOX5 Peptide - C-terminal region

ALOX5 Peptide - C-terminal region

Product Specifications

UniProt

B7ZLS0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALOX5 Rabbit Polyclonal Antibody (orb331210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243083

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin 6 (GEMIN6) Human Gene Knockout Kit (CRISPR)
KN402296 1 Kit

Gemin 6 (GEMIN6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OR52K2 activation kit by CRISPRa
GA114705 1 Kit

Human OR52K2 activation kit by CRISPRa

Sign In for Pricing
View Details
Fluoresceinamine Maleic Acid Monoamide
TRC-F485335-1G 1 g

Fluoresceinamine Maleic Acid Monoamide

Sign In for Pricing
View Details
Coq10a Mouse Gene Knockout Kit (CRISPR)
KN503692 1 Kit

Coq10a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Lymph node
CP565717 150 µg

Tissue Protein Lysate, Lymph node

Sign In for Pricing
View Details
Prostaglandin E2
TRC-P838610-50MG 50 mg

Prostaglandin E2

Sign In for Pricing
View Details