Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPMK Peptide - middle region

IPMK Peptide - middle region

Product Specifications

UniProt

Q8NFU5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPMK Rabbit Polyclonal Antibody (orb586291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689416

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E4]
TA813028AM 100 µL

TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E4]

Sign In for Pricing
View Details
MAG Rabbit mAb
C05870-100uL*2 2x 100μL

MAG Rabbit mAb

Sign In for Pricing
View Details
Synapsin Ia/b (h) -PR
sc-37012-PR 10 µM - 20 µL

Synapsin Ia/b (h) -PR

Sign In for Pricing
View Details
SYT17 (Synaptotagmin 17) (MaxLight 405)
MBS6439811-01 0.1 mL

SYT17 (Synaptotagmin 17) (MaxLight 405)

Sign In for Pricing
View Details
SYT17 (Synaptotagmin 17) (MaxLight 405)
MBS6439811-02 5x 0.1 mL

SYT17 (Synaptotagmin 17) (MaxLight 405)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-30e-5p Vector
mm30548 500 ng

LentimiRa-Off-mmu-miR-30e-5p Vector

Sign In for Pricing
View Details