Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPMK Peptide - middle region

IPMK Peptide - middle region

Product Specifications

UniProt

Q8NFU5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPMK Rabbit Polyclonal Antibody (orb586291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689416

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nat2 (NM_010874) Mouse Tagged ORF Clone Lentiviral Particle
MR217509L4V 200 µL

Nat2 (NM_010874) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DHTKD1 Human Over-expression Lysate
orb1370016 20 µg

DHTKD1 Human Over-expression Lysate

Sign In for Pricing
View Details
CRMP1 Rabbit Monoclonal Antibody
AMRe84121-01 1 Each

CRMP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CRMP1 Rabbit Monoclonal Antibody
AMRe84121-02 50 µL

CRMP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CRMP1 Rabbit Monoclonal Antibody
AMRe84121-03 100 µL

CRMP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Fam175b sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3709803 1.0 µg DNA

Fam175b sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details