Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGLON5 Peptide - C-terminal region

IGLON5 Peptide - C-terminal region

Product Specifications

UniProt

A6NGN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGLON5 Rabbit Polyclonal Antibody (orb587457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094842

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL5 Protein Vector (Human) (pPM-C-HA)
20304021 500 ng

FBXL5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Monkey Calponin-3 (CNN3) ELISA Kit
MBS7223978-01 48 Well

Monkey Calponin-3 (CNN3) ELISA Kit

Sign In for Pricing
View Details
Monkey Calponin-3 (CNN3) ELISA Kit
MBS7223978-02 96 Well

Monkey Calponin-3 (CNN3) ELISA Kit

Sign In for Pricing
View Details
Monkey Calponin-3 (CNN3) ELISA Kit
MBS7223978-03 5x 96 Well

Monkey Calponin-3 (CNN3) ELISA Kit

Sign In for Pricing
View Details
Monkey Calponin-3 (CNN3) ELISA Kit
MBS7223978-04 10x 96 Well

Monkey Calponin-3 (CNN3) ELISA Kit

Sign In for Pricing
View Details
ANO4 Protein Vector (Mouse) (pPB-N-His)
PV154779 500 ng

ANO4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details