Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGLON5 Peptide - C-terminal region

IGLON5 Peptide - C-terminal region

Product Specifications

UniProt

A6NGN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGLON5 Rabbit Polyclonal Antibody (orb587457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094842

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR3C 3'UTR GFP Stable Cell Line
TU050263 1.0 mL

ACTR3C 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody
abx320943-01 20 µL

Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody

Sign In for Pricing
View Details
Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody
abx320943-02 50 µL

Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody

Sign In for Pricing
View Details
Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody
abx320943-03 100 µL

Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody

Sign In for Pricing
View Details
Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody
abx320943-04 200 µL

Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody

Sign In for Pricing
View Details
Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody
abx320943-05 1 mL

Zinc Finger And BTB Domain-Containing Protein 20 (ZBTB20) Antibody

Sign In for Pricing
View Details