Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4C11 Peptide - C-terminal region

OR4C11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-136, OR4C11P

UniProt

Q6IEV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4C11 Rabbit Polyclonal Antibody (orb327051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004700

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWHGKIISENKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sonic Hedgehog/SHH (C24II), Tag Free
HA211279-01 20 µg

Human Sonic Hedgehog/SHH (C24II), Tag Free

Sign In for Pricing
View Details
Human Sonic Hedgehog/SHH (C24II), Tag Free
HA211279-02 50 µg

Human Sonic Hedgehog/SHH (C24II), Tag Free

Sign In for Pricing
View Details
Human Sonic Hedgehog/SHH (C24II), Tag Free
HA211279-03 100 µg

Human Sonic Hedgehog/SHH (C24II), Tag Free

Sign In for Pricing
View Details
Human CD300LD-AS1 activation kit by CRISPRa
GA115575 1 Kit

Human CD300LD-AS1 activation kit by CRISPRa

Sign In for Pricing
View Details
Retnlb Mouse Gene Knockout Kit (CRISPR)
KN514679 1 Kit

Retnlb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SMIM10L2B activation kit by CRISPRa
GA118736 1 Kit

Human SMIM10L2B activation kit by CRISPRa

Sign In for Pricing
View Details