OR4C11 Peptide - C-terminal region
OR4C11 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-136, OR4C11P
UniProt
Q6IEV9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4C11 Rabbit Polyclonal Antibody (orb327051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004700
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWHGKIISENKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
11001-AAT 1 L
ReadiUse™ ABTS Substrate Solution *Optimized for ELISA Assays with HRP Conjugates*
Sign In for Pricing
View Details 
BNC470971-100 1x 100 µL
Myeloid-Associated Differentiation Marker (MYADM/971), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![RUVBL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]](https://cdn.genprice.uk/products/937/68dd1b6d061270361ea171a6/imageurl/ta504285bm.webp)
TA504285BM 100 µL
RUVBL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]
Sign In for Pricing
View Details 