Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4E2 Peptide - C-terminal region

OR4E2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR14-42

UniProt

Q8NGC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4E2 Rabbit Polyclonal Antibody (orb587596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001912

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQLRQRQVFFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT1A9 Rabbit Polyclonal Antibody
orb578528 100 µL

UGT1A9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNH8 Protein Vector (Rat) (pPM-C-His)
PV275741 500 ng

KCNH8 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)
MBS6195426-01 0.1 mL

FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)

Sign In for Pricing
View Details
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)
MBS6195426-02 5x 0.1 mL

FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Anti-Human CLN5 Polyclonal Antibody
PA87388HU-01 50 µg

Rabbit Anti-Human CLN5 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CLN5 Polyclonal Antibody
PA87388HU-02 100 µg

Rabbit Anti-Human CLN5 Polyclonal Antibody

Sign In for Pricing
View Details