Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4E2 Peptide - C-terminal region

OR4E2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR14-42

UniProt

Q8NGC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4E2 Rabbit Polyclonal Antibody (orb587596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001912

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQLRQRQVFFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neurokinin B (NKB)
TRV-0037678-01 10 µg

Recombinant Neurokinin B (NKB)

Sign In for Pricing
View Details
Recombinant Neurokinin B (NKB)
TRV-0037678-02 50 µg

Recombinant Neurokinin B (NKB)

Sign In for Pricing
View Details
Recombinant Neurokinin B (NKB)
TRV-0037678-03 100 µg

Recombinant Neurokinin B (NKB)

Sign In for Pricing
View Details
Recombinant Neurokinin B (NKB)
TRV-0037678-04 200 µg

Recombinant Neurokinin B (NKB)

Sign In for Pricing
View Details
Recombinant Neurokinin B (NKB)
TRV-0037678-05 500 µg

Recombinant Neurokinin B (NKB)

Sign In for Pricing
View Details
Recombinant Neurokinin B (NKB)
TRV-0037678-06 1 mg

Recombinant Neurokinin B (NKB)

Sign In for Pricing
View Details