Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4K1 Peptide - C-terminal region

OR4K1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR14-19

UniProt

Q8NGD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4K1 Rabbit Polyclonal Antibody (orb587599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004063

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWKLRNRHVNSWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (FLJ25987, MGC8385, Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB) (Biotin)
U1000-03C-Biotin 100 µL

Ubiquitin (FLJ25987, MGC8385, Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB) (Biotin)

Sign In for Pricing
View Details
GTF2E1 Antibody - N-terminal region
OAAB10733-400UL 400 µL

GTF2E1 Antibody - N-terminal region

Sign In for Pricing
View Details
Human HIST1H2BH knockdown cell line
ABC-KD6790 1 Vial

Human HIST1H2BH knockdown cell line

Sign In for Pricing
View Details
MET2 Antibody
orb847761 2 mg

MET2 Antibody

Sign In for Pricing
View Details
Recombinant Bovine Collectin-12 (COLEC12) , partial
MBS7054418 Inquire

Recombinant Bovine Collectin-12 (COLEC12) , partial

Sign In for Pricing
View Details
C1orf174 Rabbit Polyclonal Antibody (BF647)
orb2510478 100 µL

C1orf174 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details