Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4Q3 Peptide - C-terminal region

OR4Q3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf13, HSA6, OR14-3, OR4Q4, c14_5008

UniProt

Q8NH05

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4Q3 Rabbit Polyclonal Antibody (orb587600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_751944

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMKKLRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C5orf20 (DCANP1) activation kit by CRISPRa
GA115435 1 Kit

Human C5orf20 (DCANP1) activation kit by CRISPRa

Sign In for Pricing
View Details
Cannabigerorcinic Acid
TRC-C175403-5MG 5 mg

Cannabigerorcinic Acid

Sign In for Pricing
View Details
Retinamide
TRC-R243000-1MG 1 mg

Retinamide

Sign In for Pricing
View Details
WEE1 (C-term) Rabbit Polyclonal Antibody
AP15063PU-N 400 µL

WEE1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chromogranin A (LK2H10), 1mg/mL
BNUM0641-50 1x 50 µL

Chromogranin A (LK2H10), 1mg/mL

Sign In for Pricing
View Details
Recombinant Trk A Antibody
RC-16816-01 50 μL

Recombinant Trk A Antibody

Sign In for Pricing
View Details