Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4Q3 Peptide - C-terminal region

OR4Q3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf13, HSA6, OR14-3, OR4Q4, c14_5008

UniProt

Q8NH05

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4Q3 Rabbit Polyclonal Antibody (orb587600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_751944

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMKKLRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Amino-2-naphthol-4-sulfonic Acid
TRC-A619008-500MG 500 mg

1-Amino-2-naphthol-4-sulfonic Acid

Sign In for Pricing
View Details
BMF Mouse Monoclonal Antibody [Clone ID: OTI6F3]
CF807459 100 µg

BMF Mouse Monoclonal Antibody [Clone ID: OTI6F3]

Sign In for Pricing
View Details
Cardiac Troponin I (TNNI3) (NM_000363) Human Over-expression Lysate
LC424766 20 µg

Cardiac Troponin I (TNNI3) (NM_000363) Human Over-expression Lysate

Sign In for Pricing
View Details
Ginsenoside Rd
TRC-G387620-1MG 1 mg

Ginsenoside Rd

Sign In for Pricing
View Details
GADD45B (NM_015675) Human Recombinant Protein
TP720537 10 µg

GADD45B (NM_015675) Human Recombinant Protein

Sign In for Pricing
View Details
Sarilumab Biosimilar - Research Grade
ICH5107-1mg 1 mg

Sarilumab Biosimilar - Research Grade

Sign In for Pricing
View Details